PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g11315.1.p
Common NameBRADI_5g11315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 478aa    MW: 54371.4 Da    PI: 5.1129
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g11315.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR159.69.8e-19134259290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk......................................tekerrtra 56 
                        Yn+YA++ GFs++ ++s+ s  ++ + k++fvC+k  k+++ ++                                        +++r++++
  Bradi5g11315.1.p 134 HYNAYARMKGFSIKSNTSRWSAFTNLVEKHQFVCNKFRKPKPIDDVagqtskagiystkvpreesssdeehraarteetlvmkkVVRKRKRES 226
                       6***************************************998887999*********************************9989999999* PP

              FAR1  57 etrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        ++t+Ckak++ k+  dg+wev+ +++eHnHel 
  Bradi5g11315.1.p 227 IKQTECKAKMTAKLI-DGRWEVIFFVNEHNHELI 259
                       ***************.****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.3E-16134259IPR004330FAR1 DNA binding domain
PfamPF105513.0E-33382476IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MLDLNEIPCD PDDAPQEGVE PAYCTPIAPV AVHEEVGESP ATIRIADNEP LIVAPIAEYN  60
TGVAEHNTIV AEDSTGVAEH NTIVAEDSTG VAEDTTRVAC EAPADAEQEL EYRSQPQEPF  120
LGMRFDTLAG AKEHYNAYAR MKGFSIKSNT SRWSAFTNLV EKHQFVCNKF RKPKPIDDVA  180
GQTSKAGIYS TKVPREESSS DEEHRAARTE ETLVMKKVVR KRKRESIKQT ECKAKMTAKL  240
IDGRWEVIFF VNEHNHELIT KPSLTKYLLS HKNISPEEED FLRILDDCNL QTGQMMQLMS  300
RFYANGFIVP YKTKTISNFR FKIRAERKGD DMAETVSYFI AKQKEDLSFY FNVKMDEEDR  360
VELLFWVDGA ARKAYTESYH DCISFDTTYL TNQYNMPFAP FIGINCHGQS FMLGYGFMRD  420
ETTSSFDWLF QQYLDAMGGQ APLNIITDQD NAMRASIVNM FPNTVLRNCR WHIMKKA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216222KVVRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233530.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3E4T20.0A0A0Q3E4T2_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7287518
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-50FAR1-related sequence 5